Prdx1 (Mouse) Recombinant Protein
  • Prdx1 (Mouse) Recombinant Protein

Prdx1 (Mouse) Recombinant Protein

Ref: AB-P7974
Prdx1 (Mouse) Recombinant Protein

Información del producto

Mouse Prdx1 (P35700, 1 a.a. - 199 a.a.) full length recombinant protein with His tag expressed in Baculovirus expression system.
Información adicional
Size 100 ug
Gene Name Prdx1
Gene Alias MSP23|NkefA|OSF-3|OSF3|PAG|Paga|PrdxI|PrxI|TDX2|TPxA|Tdpx2
Gene Description peroxiredoxin 1
Storage Conditions Store at 2C to 8C for 1 week. For long term storage, aliquot and store at -20C to -80C.
Aliquot to avoid repeated freezing and thawing.
Application Key Func,SDS-PAGE
Immunogen Prot. Seq MSSGNAKIGYPAPNFKATAVMPDGQFKDISLSEYKGKYVVFFFYPLDFTFVCPTEIIAFSDRADEFKKLNCQVIGASVDSHFCHLAWINTPKKQGGLGPMNIPLISDPKRTIAQDYGVLKADEGISFRGLFIIDDKGILRQITINDLPVGRSVDEIIRLVQAFQFTDKHGEVCPAGWKPGSDTIKPDVNKSKEYFSKQK
Form Liquid
Quality control testing 3 ug by SDS-PAGE under reducing condition and visualized by Coomassie blue stain.
Storage Buffer In Phosphate-Buffer Saline pH 7.4 (10% glycerol)
Gene ID 18477

Enviar un mensaje


Prdx1 (Mouse) Recombinant Protein

Prdx1 (Mouse) Recombinant Protein