NME3 (Human) Recombinant Protein
  • NME3 (Human) Recombinant Protein

NME3 (Human) Recombinant Protein

Ref: AB-P7964
NME3 (Human) Recombinant Protein

Información del producto

Human NME3 (Q13232, 22 a.a. - 169 a.a.) partial length recombinant protein with His tag expressed in Escherichia coli.
Información adicional
Size 100 ug
Gene Name NME3
Gene Alias DR-nm23|KIAA0516|NDPK-C|NDPKC|NM23-H3|c371H6.2
Gene Description non-metastatic cells 3, protein expressed in
Storage Conditions Store at 2C to 8C for 1 week. For long term storage, aliquot and store at -20C to -80C.
Aliquot to avoid repeated freezing and thawing.
Application Key Func,SDS-PAGE
Immunogen Prot. Seq ERTFLAVKPDGVQRRLVGEIVRRFERKGFKLVALKLVQASEELLREHYAELRERPFYGRLVKYMASGPVVAMVWQGLDVVRTSRALIGATNPADAPPGTIRGDFCIEVGKNLIHGSDSVESARREIALWFRADELLCWEDSAGHWLYE
Form Liquid
Quality control testing 3 ug by SDS-PAGE under reducing condition and visualized by Coomassie blue stain.
Storage Buffer In 20mM Tris-HCl pH 8.0 (50% glycerol, 0.1 M NaCl, 2 mM DTT)
Gene ID 4832

Enviar un mensaje


NME3 (Human) Recombinant Protein

NME3 (Human) Recombinant Protein