NME4 (Human) Recombinant Protein
  • NME4 (Human) Recombinant Protein

NME4 (Human) Recombinant Protein

Ref: AB-P7963
NME4 (Human) Recombinant Protein

Información del producto

Human NME4 (O00746, 33 a.a. - 187 a.a.) partial length recombinant protein with His tag expressed in Escherichia coli.
Información adicional
Size 50 ug
Gene Name NME4
Gene Alias NDPK-D|NM23H4|nm23-H4
Gene Description non-metastatic cells 4, protein expressed in
Storage Conditions Store at 2C to 8C for 1 week. For long term storage, aliquot and store at -20C to -80C.
Aliquot to avoid repeated freezing and thawing.
Application Key Func,SDS-PAGE
Immunogen Prot. Seq PSWTRERTLVAVKPDGVQRRLVGDVIQRFERRGFTLVGMKMLQAPESVLAEHYQDLRRKPFYPALIRYMSSGPVVAMVWEGYNVVRASRAMIGHTDSAEAAPGTIRGDFSVHISRNVIHASDSVEGAQREIQLWFQSSELVSWADGGQHSSIHPA
Form Liquid
Quality control testing 3 ug by SDS-PAGE under reducing condition and visualized by Coomassie blue stain.
Storage Buffer In 20mM Tris-HCl pH 8.0 (40% glycerol, 0.2 M NaCl)
Gene ID 4833

Enviar un mensaje


NME4 (Human) Recombinant Protein

NME4 (Human) Recombinant Protein