AB-P7963
Producto nuevo
Este producto ya no esta disponible
Fecha disponibilidad
Comprando este producto generará 3 Biopuntos. Su cesta contiene un total 3 Biopuntos puede ser convertido en un Biobonos Descuento 12.00EUR.
Size | 50 ug |
Gene Name | NME4 |
Gene Alias | NDPK-D|NM23H4|nm23-H4 |
Gene Description | non-metastatic cells 4, protein expressed in |
Storage Conditions | Store at 2ºC to 8ºC for 1 week. For long term storage, aliquot and store at -20ºC to -80ºC.<br>Aliquot to avoid repeated freezing and thawing. |
Application Key | Func,SDS-PAGE |
Immunogen Prot. Seq | PSWTRERTLVAVKPDGVQRRLVGDVIQRFERRGFTLVGMKMLQAPESVLAEHYQDLRRKPFYPALIRYMSSGPVVAMVWEGYNVVRASRAMIGHTDSAEAAPGTIRGDFSVHISRNVIHASDSVEGAQREIQLWFQSSELVSWADGGQHSSIHPA |
Form | Liquid |
Quality control testing | 3 ug by SDS-PAGE under reducing condition and visualized by Coomassie blue stain. |
Storage Buffer | In 20mM Tris-HCl pH 8.0 (40% glycerol, 0.2 M NaCl) |
Gene ID | 4833 |