glk (iEscherichia coli/i) Recombinant Protein Ver mas grande

glk (iEscherichia coli/i) Recombinant Protein

AB-P7955

Producto nuevo

glk (Escherichia coli) Recombinant Protein

Más detalles

Por favor regístrese para ver el precio

Comprando este producto generará 3 Biopuntos. Su cesta contiene un total 3 Biopuntos puede ser convertido en un Biobonos Descuento 12.00EUR.


Hoja técnica

Size 100 ug
Gene Name glk
Gene Alias ECK2384|JW2385
Gene Description glucokinase
Storage Conditions Store at 2ºC to 8ºC for 1 week. For long term storage, aliquot and store at -20ºC to -80ºC.<br>Aliquot to avoid repeated freezing and thawing.
Application Key Func,SDS-PAGE
Immunogen Prot. Seq MTKYALVGDVGGTNARLALCDIASGEISQAKTYSGLDYPSLEAVIRVYLEEHKVEVKDGCIAIACPITGDWVAMTNHTWAFSIAEMKKNLGFSHLEIINDFTAVSMAIPMLKKEHLIQFGGAEPVEGKPIAVYGAGTGLGVAHLVHVDKRWVSLPGEGGHVDFAPNSEEEAIILEILRAEIGHVSAERVLSGPGLVNLYRAIVKADNRLPENLKPKDITERALADSCTDCRRALSLFCVIMGRFGGNLALNLGTF
Form Liquid
Quality control testing 3 ug by SDS-PAGE under reducing condition and visualized by Coomassie blue stain.
Storage Buffer In 20mM Tris-HCl pH 8.0 (10% glycerol, 0.15 M NaCl)
Gene ID 946858

Más información

E.coli glk (P0A6V8, 1 a.a. - 321 a.a.) full length recombinant protein with His tag expressed in Escherichia coli.

Consulta sobre un producto

glk (iEscherichia coli/i) Recombinant Protein

glk (iEscherichia coli/i) Recombinant Protein