Ver mas grande
Tnf (Mouse) Recombinant Protein
AB-P7950
Producto nuevo
Tnf (Mouse) Recombinant Protein
Comprando este producto generará 8 Biopuntos. Su cesta contiene un total 8 Biopuntos puede ser convertido en un Biobonos Descuento 32.00EUR.
Hoja técnica
| Size | 100 ug |
| Gene Name | Tnf |
| Gene Alias | DIF|MGC151434|TNF-alpha|TNFSF2|TNFalpha|Tnfa|Tnfsf1a |
| Gene Description | tumor necrosis factor |
| Storage Conditions | Store at 2ºC to 8ºC for 1 week. For long term storage, aliquot and store at -20ºC to -80ºC.<br>Aliquot to avoid repeated freezing and thawing. |
| Application Key | Func,SDS-PAGE |
| Immunogen Prot. Seq | RDVELAEEALPQKMGGFQNSRRCLCLSLFSFLLVAGATTLFCLLNFGVIGPQRDEKFPNGLPLISSMAQTLTLRSSSQNSSDKPVAHVVANHQVEEQLEWLSQRANALLANGMDLKDNQLVVPADGLYLVYSQVLFKGQGCPDYVLLTHTVSRFAISYQEKVNLLSAVKSPCPKDTPEGAELKPWYEPIYLGGVFQLEKGDQLSAEVNLPKYLDFAESGQVYFGVIAL |
| Form | Liquid |
| Quality control testing | 3 ug by SDS-PAGE under reducing condition and visualized by Coomassie blue stain. |
| Storage Buffer | In Phosphate-Buffer Saline pH 7.4 |
| Gene ID | 21926 |
Más información
Mouse Tnf (P06804, 8 a.a. - 235 a.a.) partial length recombinant protein with His tag expressed in Baculovirus expression system.