Tnf (Mouse) Recombinant Protein
  • Tnf (Mouse) Recombinant Protein

Tnf (Mouse) Recombinant Protein

Ref: AB-P7950
Tnf (Mouse) Recombinant Protein

Información del producto

Mouse Tnf (P06804, 8 a.a. - 235 a.a.) partial length recombinant protein with His tag expressed in Baculovirus expression system.
Información adicional
Size 100 ug
Gene Name Tnf
Gene Alias DIF|MGC151434|TNF-alpha|TNFSF2|TNFalpha|Tnfa|Tnfsf1a
Gene Description tumor necrosis factor
Storage Conditions Store at 2C to 8C for 1 week. For long term storage, aliquot and store at -20C to -80C.
Aliquot to avoid repeated freezing and thawing.
Application Key Func,SDS-PAGE
Immunogen Prot. Seq RDVELAEEALPQKMGGFQNSRRCLCLSLFSFLLVAGATTLFCLLNFGVIGPQRDEKFPNGLPLISSMAQTLTLRSSSQNSSDKPVAHVVANHQVEEQLEWLSQRANALLANGMDLKDNQLVVPADGLYLVYSQVLFKGQGCPDYVLLTHTVSRFAISYQEKVNLLSAVKSPCPKDTPEGAELKPWYEPIYLGGVFQLEKGDQLSAEVNLPKYLDFAESGQVYFGVIAL
Form Liquid
Quality control testing 3 ug by SDS-PAGE under reducing condition and visualized by Coomassie blue stain.
Storage Buffer In Phosphate-Buffer Saline pH 7.4
Gene ID 21926

Enviar un mensaje


Tnf (Mouse) Recombinant Protein

Tnf (Mouse) Recombinant Protein