GSTA4 (Human) Recombinant Protein
  • GSTA4 (Human) Recombinant Protein

GSTA4 (Human) Recombinant Protein

Ref: AB-P7941
GSTA4 (Human) Recombinant Protein

Información del producto

Human GSTA4 (O15217, 1 a.a. - 222 a.a.) full length recombinant protein with His tag expressed in Escherichia coli.
Información adicional
Size 100 ug
Gene Name GSTA4
Gene Alias DKFZp686D21185|GSTA4-4|GTA4
Gene Description glutathione S-transferase alpha 4
Storage Conditions Store at 2C to 8C for 1 week. For long term storage, aliquot and store at -20C to -80C.
Aliquot to avoid repeated freezing and thawing.
Application Key Func,SDS-PAGE
Immunogen Prot. Seq MAARPKLHYPNGRGRMESVRWVLAAAGVEFDEEFLETKEQLYKLQDGNHLLFQQVPMVEIDGMKLVQTRSILHYIADKHNLFGKNLKERTLIDMYVEGTLDLLELLIMHPFLKPDDQQKEVVNMAQKAIIRYFPVFEKILRGHGQSFLVGNQLSLADVILLQTILALEEKIPNILSAFPFLQEYTVKLSNIPTIKRFLEPGSKKKPPPDEIYVRTVYNIFRP
Form Liquid
Quality control testing 3 ug by SDS-PAGE under reducing condition and visualized by Coomassie blue stain.
Storage Buffer In 20mM Tris-HCl pH 8.0 (20% glycerol, 100 mM NaCl, 2 mM DTT)
Gene ID 2941

Enviar un mensaje


GSTA4 (Human) Recombinant Protein

GSTA4 (Human) Recombinant Protein