PDIA4 (Human) Recombinant Protein
  • PDIA4 (Human) Recombinant Protein

PDIA4 (Human) Recombinant Protein

Ref: AB-P7939
PDIA4 (Human) Recombinant Protein

Información del producto

Human PDIA4 (P13667, 21 a.a. - 645 a.a.) partial length recombinant protein with His tag expressed in Escherichia coli.
Información adicional
Size 50 ug
Gene Name PDIA4
Gene Alias ERP70|ERP72
Gene Description protein disulfide isomerase family A, member 4
Storage Conditions Store at 2C to 8C for 1 week. For long term storage, aliquot and store at -20C to -80C.
Aliquot to avoid repeated freezing and thawing.
Application Key Func,SDS-PAGE
Immunogen Prot. Seq VAGAEGPDEDSSNRENAIEDEEEEEEEDDDEEEDDLEVKEENGVLVLNDANFDNFVADKDTVLLEFYAPWCGHCKQFAPEYEKIANILKDKDPPIPVAKIDATSASVLASRFDVSGYPTIKILKKGQAVDYEGSRTQEEIVAKVREVSQPDWTPPPEVTLVLTKENFDEVVNDADIILVEFYAPWCGHCKKLAPEYEKAAKELSKRSPPIPLAKVDATAETDLAKRFDVSGYPTLKIFRKGRPYDYNGPREKYGI
Form Liquid
Quality control testing 3 ug by SDS-PAGE under reducing condition and visualized by Coomassie blue stain.
Storage Buffer In 20mM Tris-HCl pH 8.0 (10% glycerol, 0.1 M NaCl, 1 mM DTT)
Gene ID 9601

Enviar un mensaje


PDIA4 (Human) Recombinant Protein

PDIA4 (Human) Recombinant Protein