IFNG (Human) Recombinant Protein
  • IFNG (Human) Recombinant Protein

IFNG (Human) Recombinant Protein

Ref: AB-P7929
IFNG (Human) Recombinant Protein

Información del producto

Human IFNG (P01579, 24 a.a. - 161 a.a.) partial length recombinant protein expressed in Escherichia coli.
Información adicional
Size 100 ug
Gene Name IFNG
Gene Alias IFG|IFI
Gene Description interferon, gamma
Storage Conditions Store at 2C to 8C for 1 week. For long term storage, aliquot and store at -20C to -80C.
Aliquot to avoid repeated freezing and thawing.
Application Key Func,SDS-PAGE
Immunogen Prot. Seq QDPYVKEAENLKKYFNAGHSDVADNGTLFLGILKNWKEESDRKIMQSQIVSFYFKLFKNFKDDQSIQKSVETIKEDMNVKFFNSNKKKRDDFEKLTNYSVTDLNVQRKAIHELIQVMAELSPAAKTGKRKRSQMLFRG
Form Liquid
Quality control testing 3 ug by SDS-PAGE under reducing condition and visualized by Coomassie blue stain.
Storage Buffer In Phosphate-Buffer Saline pH 7.4 (10% glycerol)
Gene ID 3458

Enviar un mensaje


IFNG (Human) Recombinant Protein

IFNG (Human) Recombinant Protein