mdh (iEscherichia coli/i) Recombinant Protein
  • mdh (iEscherichia coli/i) Recombinant Protein

mdh (iEscherichia coli/i) Recombinant Protein

Ref: AB-P7925
mdh (Escherichia coli) Recombinant Protein

Información del producto

E.coli mdh (P61889, 1 a.a. - 312 a.a.) full length recombinant protein with His tag expressed in Escherichia coli.
Información adicional
Size 100 ug
Gene Name mdh
Gene Alias ECK3225|JW3205
Gene Description malate dehydrogenase, NAD(P)-binding
Storage Conditions Store at 2C to 8C for 1 week. For long term storage, aliquot and store at -20C to -80C.
Aliquot to avoid repeated freezing and thawing.
Application Key Func,SDS-PAGE
Immunogen Prot. Seq MKVAVLGAAGGIGQALALLLKTQLPSGSELSLYDIAPVTPGVAVDLSHIPTAVKIKGFSGEDATPALEGADVVLISAGVARKPGMDRSDLFNVNAGIVKNLVQQVAKTCPKACIGIITNPVNTTVAIAAEVLKKAGVYDKNKLFGVTTLDIIRSNTFVAELKGKQPGEVEVPVIGGHSGVTILPLLSQVPGVSFTEQEVADLTKRIQNAGTEVVEAKAGGGSATLSMGQAAARFGLSLVRALQGEQGVVECAYVE
Form Liquid
Quality control testing 3 ug by SDS-PAGE under reducing condition and visualized by Coomassie blue stain.
Storage Buffer In 20mM Tris-HCl pH 8.0 (10% glycerol, 50 mM NaCl, 1 mM DTT)
Gene ID 947854

Enviar un mensaje


mdh (iEscherichia coli/i) Recombinant Protein

mdh (iEscherichia coli/i) Recombinant Protein