Ver mas grande
gor (iEscherichia coli/i) Recombinant Protein
AB-P7924
Producto nuevo
gor (Escherichia coli) Recombinant Protein
Comprando este producto generará 3 Biopuntos. Su cesta contiene un total 3 Biopuntos puede ser convertido en un Biobonos Descuento 12.00EUR.
Hoja técnica
| Size | 100 ug |
| Gene Name | gor |
| Gene Alias | ECK3485|JW3467|gorA |
| Gene Description | glutathione oxidoreductase |
| Storage Conditions | Store at 2ºC to 8ºC for 1 week. For long term storage, aliquot and store at -20ºC to -80ºC.<br>Aliquot to avoid repeated freezing and thawing. |
| Application Key | Func,SDS-PAGE |
| Immunogen Prot. Seq | MTKHYDYIAIGGGSGGIASINRAAMYGQKCALIEAKELGGTCVNVGCVPKKVMWHAAQIREAIHMYGPDYGFDTTINKFNWETLIASRTAYIDRIHTSYENVLGKNNVDVIKGFARFVDAKTLEVNGETITADHILIATGGRPSHPDIPGVEYGIDSDGFFALPALPERVAVVGAGYIAVELAGVINGLGAKTHLFVRKHAPLRSFDPMISETLVEVMNAEGPQLHTNAIPKAVVKNTDGSLTLELEDGRSETVD |
| Form | Liquid |
| Quality control testing | 3 ug by SDS-PAGE under reducing condition and visualized by Coomassie blue stain. |
| Storage Buffer | In 20mM Tris-HCl pH 8.0 (10% glycerol, 0.1 M NaCl, 1 mM DTT) |
| Gene ID | 948014 |
Más información
E.coli gor (P06715, 1 a.a. - 450 a.a.) full length recombinant protein with His tag expressed in Escherichia coli.