Pecam1 (Mouse) Recombinant Protein
  • Pecam1 (Mouse) Recombinant Protein

Pecam1 (Mouse) Recombinant Protein

Ref: AB-P7919
Pecam1 (Mouse) Recombinant Protein

Información del producto

Mouse Pecam1 (Q08481, 18 a.a. - 590 a.a.) partial recombinant protein with His tag expressed in HEK293 cells.
Información adicional
Size 50 ug
Gene Name Pecam1
Gene Alias C85791|Cd31|MGC102160|PECAM-1|Pecam
Gene Description platelet/endothelial cell adhesion molecule 1
Storage Conditions Store at 4C for 1 week. For long term storage store at -20C to -80C.
Aliquot to avoid repeated freezing and thawing.
Application Key SDS-PAGE
Immunogen Prot. Seq EENSFTINSIHMESLPSWEVMNGQQLTLECLVDISTTSKSRSQHRVLFYKDDAMVYNVTSREHTESYVIPQARVFHSGKYKCTVMLNNKEKTTIEYEVKVHGVSKPKVTLDKKEVTEGGVVTVNCSLQEEKPPIFFKIEKLEVGTKFVKRRIDKTSNENFVLMEFPIEAQDHVLVFRCQAGILSGFKLQESEPIRSEYVTVQESFSTPKFEIKPPGMIIEGDQLHIRCIVQVTHLVQEFTEIIIQKDKAIVATSK
Form Liquid
Recomended Dilution Biological Activity
SDS-PAGE
The optimal working dilution should be determined by the end user.
Antigen species Target species Mouse
Quality control testing SDS-PAGE Stained with Coomassie Blue.
Storage Buffer In PBS, pH 7.4 (10% glycerol)
Gene ID 18613

Enviar un mensaje


Pecam1 (Mouse) Recombinant Protein

Pecam1 (Mouse) Recombinant Protein