Il3ra (Mouse) Recombinant Protein
  • Il3ra (Mouse) Recombinant Protein

Il3ra (Mouse) Recombinant Protein

Ref: AB-P7918
Il3ra (Mouse) Recombinant Protein

Información del producto

Mouse Il3ra (P26952, 17 a.a. - 331 a.a.) partial recombinant protein with hIgG-His tag expressed in Baculovirus.
Información adicional
Size 50 ug
Gene Name Il3ra
Gene Alias CD123|CDw123|SUT-1
Gene Description interleukin 3 receptor, alpha chain
Storage Conditions Store at 4C for 1 week. For long term storage store at -20C to -80C.
Aliquot to avoid repeated freezing and thawing.
Application Key SDS-PAGE
Immunogen Prot. Seq SDLAAVREAPPTAVTTPIQNLHIDPAHYTLSWDPAPGADITTGAFCRKGRDIFVWADPGLARCSFQSLSLCHVTNFTVFLGKDRAVAGSIQFPPDDDGDHEAAAQDLRCWVHEGQLSCQWERGPKATGDVHYRMFWRDVRLGPAHNRECPHYHSLDVNTAGPAPHGGHEGCTLDLDTVLGSTPNSPDLVPQVTITVNGSGRAGPVPCMDNTVDLQRAEVLAPPTLTVECNGSEAHARWVARNRFHHGLLGYTLQV
Form Liquid
Recomended Dilution Biological Activity
SDS-PAGE
The optimal working dilution should be determined by the end user.
Antigen species Target species Mouse
Quality control testing SDS-PAGE Stained with Coomassie Blue.
Storage Buffer In 20mM Tris-HCl buffer, 0.1M NaCl, pH 8.0 (30% glycerol)
Gene ID 16188

Enviar un mensaje


Il3ra (Mouse) Recombinant Protein

Il3ra (Mouse) Recombinant Protein