PODXL (Human) Recombinant Protein
  • PODXL (Human) Recombinant Protein

PODXL (Human) Recombinant Protein

Ref: AB-P7917
PODXL (Human) Recombinant Protein

Información del producto

Human PODXL (O00592, 23 a.a. - 429 a.a.) partial recombinant protein with His tag expressed in HEK293 cells.
Información adicional
Size 50 ug
Gene Name PODXL
Gene Alias Gp200|MGC138240|PC|PCLP
Gene Description podocalyxin-like
Storage Conditions Store at 4C for 1 week. For long term storage store at -20C to -80C.
Aliquot to avoid repeated freezing and thawing.
Application Key SDS-PAGE
Immunogen Prot. Seq SPSPSPSPSQNATQTTTDSSNKTAPTPASSVTIMATDTAQQSTVPTSKANEILASVKATTLGVSSDSPGTTTLAQQVSGPVNTTVARGGGSGNPTTTIESPKSTKSADTTTVATSTATAKPNTTSSQNGAEDTTNSGGKSSHSVTTDLTSTKAEHLTTPHPTSPLSPRQPTSTHPVATPTSSGHDHLMKISSSSSTVAIPGYTFTSPGMTTTLPSSVISQRTQQTSSQMPASSTAPSSQETVQPTSPATALRTPT
Form Liquid
Recomended Dilution Biological Activity
SDS-PAGE
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Quality control testing SDS-PAGE Stained with Coomassie Blue.
Storage Buffer In PBS, pH 7.4 (10% glycerol)
Gene ID 5420

Enviar un mensaje


PODXL (Human) Recombinant Protein

PODXL (Human) Recombinant Protein