PRCP (Human) Recombinant Protein
  • PRCP (Human) Recombinant Protein

PRCP (Human) Recombinant Protein

Ref: AB-P7915
PRCP (Human) Recombinant Protein

Información del producto

Human PRCP (P42785, 22 a.a. - 496 a.a.) partial recombinant protein with His tag expressed in HEK293 cells.
Información adicional
Size 50 ug
Gene Name PRCP
Gene Alias HUMPCP|MGC2202|PCP
Gene Description prolylcarboxypeptidase (angiotensinase C)
Storage Conditions Store at 4C for 1 week. For long term storage store at -20C to -80C.
Aliquot to avoid repeated freezing and thawing.
Application Key Func,SDS-PAGE
Immunogen Prot. Seq LRPALRALGSLHLPTNPTSLPAVAKNYSVLYFQQKVDHFGFNTVKTFNQRYLVADKYWKKNGGSILFYTGNEGDIIWFCNNTGFMWDVAEELKAMLVFAEHRYYGESLPFGDNSFKDSRHLNFLTSEQALADFAELIKHLKRTIPGAENQPVIAIGGSYGGMLAAWFRMKYPHMVVGALAASAPIWQFEDLVPCGVFMKIVTTDFRKSGPHCSESIHRSWDAINRLSNTGSGLQWLTGALHLCSPLTSQDIQHLK
Form Liquid
Recomended Dilution Biological Activity
SDS-PAGE
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Quality control testing SDS-PAGE Stained with Coomassie Blue.
Storage Buffer In PBS, pH 7.4 (30% glycerol)
Gene ID 5547

Enviar un mensaje


PRCP (Human) Recombinant Protein

PRCP (Human) Recombinant Protein