Ver mas grande
CTSD (Human) Recombinant Protein
AB-P7913
Producto nuevo
CTSD (Human) Recombinant Protein
Comprando este producto generará 5 Biopuntos. Su cesta contiene un total 5 Biopuntos puede ser convertido en un Biobonos Descuento 20.00EUR.
Hoja técnica
| Size | 50 ug |
| Gene Name | CTSD |
| Gene Alias | CLN10|CPSD|MGC2311 |
| Gene Description | cathepsin D |
| Storage Conditions | Store at 4ºC for 1 week. For long term storage store at -20ºC to -80ºC.<br>Aliquot to avoid repeated freezing and thawing. |
| Application Key | Func,SDS-PAGE |
| Immunogen Prot. Seq | LVRIPLHKFTSIRRTMSEVGGSVEDLIAKGPVSKYSQAVPAVTEGPIPEVLKNYMDAQYYGEIGIGTPPQCFTVVFDTGSSNLWVPSIHCKLLDIACWIHHKYNSDKSSTYVKNGTSFDIHYGSGSLSGYLSQDTVSVPCQSASSASALGGVKVERQVFGEATKQPGITFIAAKFDGILGMAYPRISVNNVLPVFDNLMQQKLVDQNIFSFYLSRDPDAQPGGELMLGGTDSKYYKGSLSYLNVTRKAYWQVHLD |
| Form | Liquid |
| Recomended Dilution | Biological Activity<br>SDS-PAGE<br>The optimal working dilution should be determined by the end user. |
| Antigen species Target species | Human |
| Quality control testing | SDS-PAGE Stained with Coomassie Blue. |
| Storage Buffer | In 50mM MES buffer, pH 5.5 (20% glycerol, 100mM NaCl) |
| Gene ID | 1509 |
Más información
Human CTSD (P07339, 21 a.a. - 412 a.a.) partial recombinant protein with His tag expressed in Baculovirus.