CTSD (Human) Recombinant Protein
  • CTSD (Human) Recombinant Protein

CTSD (Human) Recombinant Protein

Ref: AB-P7913
CTSD (Human) Recombinant Protein

Información del producto

Human CTSD (P07339, 21 a.a. - 412 a.a.) partial recombinant protein with His tag expressed in Baculovirus.
Información adicional
Size 50 ug
Gene Name CTSD
Gene Alias CLN10|CPSD|MGC2311
Gene Description cathepsin D
Storage Conditions Store at 4C for 1 week. For long term storage store at -20C to -80C.
Aliquot to avoid repeated freezing and thawing.
Application Key Func,SDS-PAGE
Immunogen Prot. Seq LVRIPLHKFTSIRRTMSEVGGSVEDLIAKGPVSKYSQAVPAVTEGPIPEVLKNYMDAQYYGEIGIGTPPQCFTVVFDTGSSNLWVPSIHCKLLDIACWIHHKYNSDKSSTYVKNGTSFDIHYGSGSLSGYLSQDTVSVPCQSASSASALGGVKVERQVFGEATKQPGITFIAAKFDGILGMAYPRISVNNVLPVFDNLMQQKLVDQNIFSFYLSRDPDAQPGGELMLGGTDSKYYKGSLSYLNVTRKAYWQVHLD
Form Liquid
Recomended Dilution Biological Activity
SDS-PAGE
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Quality control testing SDS-PAGE Stained with Coomassie Blue.
Storage Buffer In 50mM MES buffer, pH 5.5 (20% glycerol, 100mM NaCl)
Gene ID 1509

Enviar un mensaje


CTSD (Human) Recombinant Protein

CTSD (Human) Recombinant Protein