Il21 (Mouse) Recombinant Protein
  • Il21 (Mouse) Recombinant Protein

Il21 (Mouse) Recombinant Protein

Ref: AB-P7879
Il21 (Mouse) Recombinant Protein

Información del producto

Mouse Il21 (Q9ES17, 18 a.a. - 146 a.a.) partial recombinant protein expressed in Escherichia coli.
Información adicional
Size 500 ug
Gene Name Il21
Gene Alias -
Gene Description interleukin 21
Storage Conditions Store at 4C for 1 week. For long term storage store at -20C to -80C.
Aliquot to avoid repeated freezing and thawing.
Application Key Func,SDS-PAGE
Immunogen Prot. Seq MHKSSPQGPDRLLIRLRHLIDIVEQLKIYENDLDPELLSAPQDVKGHCEHAAFACFQKAKLKPSNPGNNKTFIIDLVAQLRRRLPARRGGKKQKHIAKCPSCDSYEKRTPKEFLERLKWLLQKMIHQHLS
Form Liquid
Recomended Dilution Biological Activity
SDS-PAGE
The optimal working dilution should be determined by the end user.
Antigen species Target species Mouse
Quality control testing SDS-PAGE Stained with Coomassie Blue.
Storage Buffer In PBS, pH 7.4
Gene ID 60505

Enviar un mensaje


Il21 (Mouse) Recombinant Protein

Il21 (Mouse) Recombinant Protein