CSNK2B (Human) Recombinant Protein
  • CSNK2B (Human) Recombinant Protein

CSNK2B (Human) Recombinant Protein

Ref: AB-P7877
CSNK2B (Human) Recombinant Protein

Información del producto

Human CSNK2B (P67870, 1 a.a. - 215 a.a.) full-length recombinant protein expressed in Escherichia coli.
Información adicional
Size 500 ug
Gene Name CSNK2B
Gene Alias CK2B|CK2N|CSK2B|G5A|MGC138222|MGC138224
Gene Description casein kinase 2, beta polypeptide
Storage Conditions Store at 4C for 1 week. For long term storage store at -20C to -80C.
Aliquot to avoid repeated freezing and thawing.
Application Key SDS-PAGE
Immunogen Prot. Seq MSSSEEVSWISWFCGLRGNEFFCEVDEDYIQDKFNLTGLNEQVPHYRQALDMILDLEPDEELEDNPNQSDLIEQAAEMLYGLIHARYILTNRGIAQMLEKYQQGDFGYCPRVYCENQPMLPIGLSDIPGEAMVKLYCPKCMDVYTPKSSRHHHTDGAYFGTGFPHMLFMVHPEYRPKRPANQFVPRLYGFKIHPMAYQLQLQAASNFKSPVKTIR
Form Liquid
Recomended Dilution SDS-PAGE
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Quality control testing SDS-PAGE Stained with Coomassie Blue.
Storage Buffer In 20mM Tris-HCl buffer, 0.15M NaCl, pH 8.0 (10% glycerol, 1mM DTT, 1mM EDTA)
Gene ID 1460

Enviar un mensaje


CSNK2B (Human) Recombinant Protein

CSNK2B (Human) Recombinant Protein