TNFRSF4 (Human) Recombinant Protein
  • TNFRSF4 (Human) Recombinant Protein

TNFRSF4 (Human) Recombinant Protein

Ref: AB-P7875
TNFRSF4 (Human) Recombinant Protein

Información del producto

Human TNFRSF4 (P43489, 29 a.a. - 214 a.a.) partial recombinant protein with hIgG-His tag expressed in Baculovirus.
Información adicional
Size 500 ug
Gene Name TNFRSF4
Gene Alias ACT35|CD134|OX40|TXGP1L
Gene Description tumor necrosis factor receptor superfamily, member 4
Storage Conditions Store at 4C for 1 week. For long term storage store at -20C to -80C.
Aliquot to avoid repeated freezing and thawing.
Application Key Func,SDS-PAGE
Immunogen Prot. Seq LHCVGDTYPSNDRCCHECRPGNGMVSRCSRSQNTVCRPCGPGFYNDVVSSKPCKPCTWCNLRSGSERKQLCTATQDTVCRCRAGTQPLDSYKPGVDCAPCPPGHFSPGDNQACKPWTNCTLAGKHTLQPASNSSDAICEDRDPPATQPQETQGPPARPITVQPTEAWPRTSQGPSTRPVEVPGGRALEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVE
Form Liquid
Recomended Dilution Biological Activity
SDS-PAGE
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Quality control testing SDS-PAGE Stained with Coomassie Blue.
Storage Buffer In PBS, pH 7.4 ( 10% glycerol)
Gene ID 7293

Enviar un mensaje


TNFRSF4 (Human) Recombinant Protein

TNFRSF4 (Human) Recombinant Protein