LILRB2 (Human) Recombinant Protein
  • LILRB2 (Human) Recombinant Protein

LILRB2 (Human) Recombinant Protein

Ref: AB-P7872
LILRB2 (Human) Recombinant Protein

Información del producto

Human LILRB2 (Q8N423, 24 a.a. - 461 a.a.) partial recombinant protein with His tag expressed in HEK293 cells.
Información adicional
Size 500 ug
Gene Name LILRB2
Gene Alias CD85D|ILT4|LILRA6|LIR-2|LIR2|MIR-10|MIR10
Gene Description leukocyte immunoglobulin-like receptor, subfamily B (with TM and ITIM domains), member 2
Storage Conditions Store at 4C for 1 week. For long term storage store at -20C to -80C.
Aliquot to avoid repeated freezing and thawing.
Application Key SDS-PAGE
Immunogen Prot. Seq GTIPKPTLWAEPDSVITQGSPVTLSCQGSLEAQEYRLYREKKSASWITRIRPELVKNGQFHIPSITWEHTGRYGCQYYSRARWSELSDPLVLVMTGAYPKPTLSAQPSPVVTSGGRVTLQCESQVAFGGFILCKEGEDEHPQCLNSQPHARGSSRAIFSVGPVSPNRRWSHRCYGYDLNSPYVWSSPSDLLELLVPGVSKKPSLSVQPGPVMAPGESLTLQCVSDVGYDRFVLYKEGERDLRQLPGRQPQAGLSQ
Form Liquid
Recomended Dilution SDS-PAGE
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Quality control testing SDS-PAGE Stained with Coomassie Blue.
Storage Buffer In PBS, pH 7.4 ( 20% glycerol)
Gene ID 10288

Enviar un mensaje


LILRB2 (Human) Recombinant Protein

LILRB2 (Human) Recombinant Protein