Ver mas grande
LILRB2 (Human) Recombinant Protein
AB-P7872
Producto nuevo
LILRB2 (Human) Recombinant Protein
Comprando este producto generará 19 Biopuntos. Su cesta contiene un total 19 Biopuntos puede ser convertido en un Biobonos Descuento 76.00EUR.
Hoja técnica
| Size | 500 ug |
| Gene Name | LILRB2 |
| Gene Alias | CD85D|ILT4|LILRA6|LIR-2|LIR2|MIR-10|MIR10 |
| Gene Description | leukocyte immunoglobulin-like receptor, subfamily B (with TM and ITIM domains), member 2 |
| Storage Conditions | Store at 4ºC for 1 week. For long term storage store at -20ºC to -80ºC.<br>Aliquot to avoid repeated freezing and thawing. |
| Application Key | SDS-PAGE |
| Immunogen Prot. Seq | GTIPKPTLWAEPDSVITQGSPVTLSCQGSLEAQEYRLYREKKSASWITRIRPELVKNGQFHIPSITWEHTGRYGCQYYSRARWSELSDPLVLVMTGAYPKPTLSAQPSPVVTSGGRVTLQCESQVAFGGFILCKEGEDEHPQCLNSQPHARGSSRAIFSVGPVSPNRRWSHRCYGYDLNSPYVWSSPSDLLELLVPGVSKKPSLSVQPGPVMAPGESLTLQCVSDVGYDRFVLYKEGERDLRQLPGRQPQAGLSQ |
| Form | Liquid |
| Recomended Dilution | SDS-PAGE<br>The optimal working dilution should be determined by the end user. |
| Antigen species Target species | Human |
| Quality control testing | SDS-PAGE Stained with Coomassie Blue. |
| Storage Buffer | In PBS, pH 7.4 ( 20% glycerol) |
| Gene ID | 10288 |
Más información
Human LILRB2 (Q8N423, 24 a.a. - 461 a.a.) partial recombinant protein with His tag expressed in HEK293 cells.