Timp1 (Mouse) Recombinant Protein
  • Timp1 (Mouse) Recombinant Protein

Timp1 (Mouse) Recombinant Protein

Ref: AB-P7870
Timp1 (Mouse) Recombinant Protein

Información del producto

Mouse Timp1 (P12032, 25 a.a. - 205 a.a.) partial recombinant protein with His tag expressed in Baculovirus.
Información adicional
Size 500 ug
Gene Name Timp1
Gene Alias Clgi|MGC7143|TIMP-1|Timp
Gene Description tissue inhibitor of metalloproteinase 1
Storage Conditions Store at 4C for 1 week. For long term storage store at -20C to -80C.
Aliquot to avoid repeated freezing and thawing.
Application Key SDS-PAGE
Immunogen Prot. Seq CSCAPPHPQTAFCNSDLVIRAKFMGSPEINETTLYQRYKIKMTKMLKGFKAVGNAADIRYAYTPVMESLCGYAHKSQNRSEEFLITGRLRNGNLHISACSFLVPWRTLSPAQQRAFSKTYSAGCGVCTVFPCLSIPCKLESDTHCLWTDQVLVGSEDYQSRHFACLPRNPGLCTWRSLGAR
Form Liquid
Recomended Dilution SDS-PAGE
The optimal working dilution should be determined by the end user.
Antigen species Target species Mouse
Quality control testing SDS-PAGE Stained with Coomassie Blue.
Storage Buffer In PBS, pH 7.4 (10% glycerol)
Gene ID 21857

Enviar un mensaje


Timp1 (Mouse) Recombinant Protein

Timp1 (Mouse) Recombinant Protein