EPHB1 (Human) Recombinant Protein
  • EPHB1 (Human) Recombinant Protein

EPHB1 (Human) Recombinant Protein

Ref: AB-P7868
EPHB1 (Human) Recombinant Protein

Información del producto

Human EPHB1 (P54762, 18 a.a. - 540 a.a.) partial recombinant protein with His tag expressed in HEK293 cells.
Información adicional
Size 500 ug
Gene Name EPHB1
Gene Alias ELK|EPHT2|FLJ37986|Hek6|NET
Gene Description EPH receptor B1
Storage Conditions Store at 4C for 1 week. For long term storage store at -20C to -80C.
Aliquot to avoid repeated freezing and thawing.
Application Key Func,SDS-PAGE
Immunogen Prot. Seq MEETLMDTRTATAELGWTANPASGWEEVSGYDENLNTIRTYQVCNVFEPNQNNWLLTTFINRRGAHRIYTEMRFTVRDCSSLPNVPGSCKETFNLYYYETDSVIATKKSAFWSEAPYLKVDTIAADESFSQVDFGGRLMKVNTEVRSFGPLTRNGFYLAFQDYGACMSLLSVRVFFKKCPSIVQNFAVFPETMTGAESTSLVIARGTCIPNAEEVDVPIKLYCNGDGEWMVPIGRCTCKPGYEPENSVACKACPA
Form Liquid
Recomended Dilution Biological Activity
SDS-PAGE
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Quality control testing SDS-PAGE Stained with Coomassie Blue.
Storage Buffer In PBS, pH 7.4 (10% glycerol)
Gene ID 2047

Enviar un mensaje


EPHB1 (Human) Recombinant Protein

EPHB1 (Human) Recombinant Protein