EPCAM (Human) Recombinant Protein
  • EPCAM (Human) Recombinant Protein

EPCAM (Human) Recombinant Protein

Ref: AB-P7843
EPCAM (Human) Recombinant Protein

Información del producto

Human EPCAM recombinant protein with polyhistidine tag at the C-terminus expressed in Escherichia coli.
Información adicional
Size 20 ug
Gene Name EPCAM
Gene Alias 17-1A|323/A3|CD326|CO-17A|CO17-1A|EGP|EGP-2|EGP34|EGP40|ESA|Ep-CAM|GA733-2|HEA125|KS1/4|KSA|M4S1|MH99|MIC18|MK-1|MOC31|TACST-1|TACSTD1|TROP1|hEGP-2
Gene Description epithelial cell adhesion molecule
Storage Conditions Lyophilized protein should be stored at -20C. Protein aliquots should be stored at-20C to -80C. This product is stable for one year.
Avoid repeated freeze/thaw cycles.
Application Key Func,SDS-PAGE
Immunogen Prot. Seq MQEECVCENYKLAVNCFVNNNRQCQCTSVGAQNTVICSKLAAKCLVMKAEMNGSKLGRRAKPEGALQNNDGLYDPDCDESGLFKAKQCNGTSMCWCVNTAGVRRTDKDTEITCSERVRTYWIIIELKHKAREKPYDSKSLRTALQKEITTRYQLDPKFITSILYENNVITIDLVQNSSQKTQNDVDIADVAYYFEKDVKGESLFHSKKMDLTVNGEQLDLDPGQTLIYYVDEKAPEFSMQGLK with polyhi
Form Lyophilized
Recomended Dilution Biological Activity
SDS-PAGE
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Quality control testing SDS-PAGE Stained with Coomassie Blue.
Storage Buffer Lyophilized from a solution containing 1X PBS, pH 8.0. Reconstitute the lyophilized powder in ddH2O to 100 ug/mL.
Gene ID 4072

Enviar un mensaje


EPCAM (Human) Recombinant Protein

EPCAM (Human) Recombinant Protein