Ver mas grande
EPCAM (Human) Recombinant Protein
AB-P7843
Producto nuevo
EPCAM (Human) Recombinant Protein
Comprando este producto generará 3 Biopuntos. Su cesta contiene un total 3 Biopuntos puede ser convertido en un Biobonos Descuento 12.00EUR.
Hoja técnica
| Size | 20 ug |
| Gene Name | EPCAM |
| Gene Alias | 17-1A|323/A3|CD326|CO-17A|CO17-1A|EGP|EGP-2|EGP34|EGP40|ESA|Ep-CAM|GA733-2|HEA125|KS1/4|KSA|M4S1|MH99|MIC18|MK-1|MOC31|TACST-1|TACSTD1|TROP1|hEGP-2 |
| Gene Description | epithelial cell adhesion molecule |
| Storage Conditions | Lyophilized protein should be stored at -20ºC. Protein aliquots should be stored at-20ºC to -80ºC. This product is stable for one year. <br>Avoid repeated freeze/thaw cycles. |
| Application Key | Func,SDS-PAGE |
| Immunogen Prot. Seq | MQEECVCENYKLAVNCFVNNNRQCQCTSVGAQNTVICSKLAAKCLVMKAEMNGSKLGRRAKPEGALQNNDGLYDPDCDESGLFKAKQCNGTSMCWCVNTAGVRRTDKDTEITCSERVRTYWIIIELKHKAREKPYDSKSLRTALQKEITTRYQLDPKFITSILYENNVITIDLVQNSSQKTQNDVDIADVAYYFEKDVKGESLFHSKKMDLTVNGEQLDLDPGQTLIYYVDEKAPEFSMQGLK with polyhi |
| Form | Lyophilized |
| Recomended Dilution | Biological Activity<br>SDS-PAGE<br>The optimal working dilution should be determined by the end user. |
| Antigen species Target species | Human |
| Quality control testing | SDS-PAGE Stained with Coomassie Blue. |
| Storage Buffer | Lyophilized from a solution containing 1X PBS, pH 8.0. Reconstitute the lyophilized powder in ddH<sub>2</sub>O to 100 ug/mL. |
| Gene ID | 4072 |
Más información
Human EPCAM recombinant protein with polyhistidine tag at the C-terminus expressed in Escherichia coli.