LGALS4 (Human) Recombinant Protein
  • LGALS4 (Human) Recombinant Protein

LGALS4 (Human) Recombinant Protein

Ref: AB-P7833
LGALS4 (Human) Recombinant Protein

Información del producto

Human LGALS4 recombinant protein with polyhistidine tag at the N-terminus expressed in Escherichia coli.
Información adicional
Size 20 ug
Gene Name LGALS4
Gene Alias GAL4|L36LBP
Gene Description lectin, galactoside-binding, soluble, 4
Storage Conditions Lyophilized protein should be stored at -20C. Protein aliquots should be stored at-20C to -80C. This product is stable for one year.
Avoid repeated freeze/thaw cycles.
Application Key Func,SDS-PAGE
Immunogen Prot. Seq AYVPAPGYQPTYNPTLPYYQPIPGGLNVGMSVYIQGVASEHMKRFFVNFVVGQDPGSDVAFHFNPRFDGWDKVVFNTLQGGKWGSEERKRSMPFKKGAAFELVFIVLAEHYKVVVNGNPFYEYGHRLPLQMVTHLQVDGDLQLQSINFIGGQPLRPQGPPMMPPYPGPGHCHQQLNSLPTMEGPPTFNPPVPYFGRLQGGLTARRTIIIKGYVPPTGKSFAINFKVGSSGDIALHINPRMGNGTVVRNSLLNGSW
Form Lyophilized
Recomended Dilution Biological Activity
SDS-PAGE
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Quality control testing SDS-PAGE Stained with Coomassie Blue.
Storage Buffer Lyophilized from a solution containing 1X PBS, pH 7.4. Reconstitute the lyophilized powder in ddH2O to 100 ug/mL.
Gene ID 3960

Enviar un mensaje


LGALS4 (Human) Recombinant Protein

LGALS4 (Human) Recombinant Protein