THOC7 (Human) Recombinant Protein
  • THOC7 (Human) Recombinant Protein

THOC7 (Human) Recombinant Protein

Ref: AB-P7793
THOC7 (Human) Recombinant Protein

Información del producto

Human THOC7 (NP_079351, 1 a.a. - 204 a.a ) full-length recombinant protein with His tag expressed in Escherichia coli.
Información adicional
Size 250 ug
Gene Name THOC7
Gene Alias FLJ23445|NIF3L1BP1|fSAP24
Gene Description THO complex 7 homolog (Drosophila)
Storage Conditions Store at 2C to 8C for 1 week. For long term storage, aliquot and store at -20C to -80C.
Aliquot to avoid repeated freezing and thawing.
Application Key SDS-PAGE
Immunogen Prot. Seq MGSSHHHHHHSSGLVPRGSHMGSMGAVTDDEVIRKRLLIDGDGAGDDRRINLLVKSFIKWCNSGSQEEGYSQYQRMLSTLSQCEFSMGKTLLVYDMNLREMENYEKIYKEIECSIAGAHEKIAECKKQILQAKRIRKNRQEYDALAKVIQHHPDRHETLKELEALGKELEHLSHIKESVEDKLELRRKQFHVLLSTIHELQQTLENDEKLSEVEEAQEASMETDPKP
Form Liquid
Recomended Dilution SDS-PAGE
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Quality control testing 3ug by SDS-PAGE under reducing condition and visualized by coomassie blue stain.
Storage Buffer In PBS, pH 7.4 (1 mM DTT, 50% glycerol).
Gene ID 80145

Enviar un mensaje


THOC7 (Human) Recombinant Protein

THOC7 (Human) Recombinant Protein