SCO1 (Human) Recombinant Protein
  • SCO1 (Human) Recombinant Protein

SCO1 (Human) Recombinant Protein

Ref: AB-P7778
SCO1 (Human) Recombinant Protein

Información del producto

Human SCO1 (NP_004580, 132 a.a. - 301 a.a ) partial recombinant protein with His tag expressed in Escherichia coli.
Información adicional
Size 500 ug
Gene Name SCO1
Gene Alias SCOD1
Gene Description SCO cytochrome oxidase deficient homolog 1 (yeast)
Storage Conditions Store at 2C to 8C for 1 week. For long term storage, aliquot and store at -20C to -80C.
Aliquot to avoid repeated freezing and thawing.
Application Key SDS-PAGE
Immunogen Prot. Seq MGKPLLGGPFSLTTHTGERKTDKDYLGQWLLIYFGFTHCPDVCPEELEKMIQVVDEIDSITTLPDLTPLFISIDPERDTKEAIANYVKEFSPKLVGLTGTREEVDQVARAYRVYYSPGPKDEDEDYIVDHTIIMYLIGPDGEFLDYFGQNKRKGEIAASIATHMRPYRKKSLEHHHHHH
Form Liquid
Recomended Dilution SDS-PAGE
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Quality control testing 3ug by SDS-PAGE under reducing condition and visualized by coomassie blue stain.
Storage Buffer In PBS, pH 7.4 (1 mM DTT, 10% glycerol).
Gene ID 6341

Enviar un mensaje


SCO1 (Human) Recombinant Protein

SCO1 (Human) Recombinant Protein