BRAF (Human) Recombinant Protein
  • BRAF (Human) Recombinant Protein

BRAF (Human) Recombinant Protein

Ref: AB-P7774
BRAF (Human) Recombinant Protein

Información del producto

Human BRAF (NP_004324.2, 432 a.a. - 766 a.a ) partial recombinant protein with His tag expressed in Escherichia coli.
Información adicional
Size 500 ug
Gene Name BRAF
Gene Alias B-RAF1|BRAF1|FLJ95109|MGC126806|MGC138284|RAFB1
Gene Description v-raf murine sarcoma viral oncogene homolog B1
Storage Conditions Store at 2C to 8C for 1 week. For long term storage, aliquot and store at -20C to -80C.
Aliquot to avoid repeated freezing and thawing.
Application Key SDS-PAGE
Immunogen Prot. Seq MGSSHHHHHHSSGLVPRGSHMGSEFSEDRNRMKTLGRRDSSDDWEIPDGQITVGQRIGSGSFGTVYKGKWHGDVAVKMLNVTAPTPQQLQAFKNEVGVLRKTRHVNILLFMGYSTKPQLAIVTQWCEGSSLYHHLHIIETKFEMIKLIDIARQTAQGMDYLHAKSIIHRDLKSNNIFLHEDLTVKIGDFGLATVKSRWSGSHQFEQLSGSILWMAPEVIRMQDKNPYSFQSDVYAFGIVLYELMTGQLPYSNINN
Form Liquid
Recomended Dilution SDS-PAGE
Denatured
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Quality control testing 3ug by SDS-PAGE under reducing condition and visualized by coomassie blue stain.
Storage Buffer In 20mM Tris-HCl buffer, pH8.0 (10% glycerol).
Gene ID 673

Enviar un mensaje


BRAF (Human) Recombinant Protein

BRAF (Human) Recombinant Protein