Ver mas grande
Tgfb1 (Mouse) Recombinant Protein
AB-P7768
Producto nuevo
Tgfb1 (Mouse) Recombinant Protein
Comprando este producto generará 11 Biopuntos. Su cesta contiene un total 11 Biopuntos puede ser convertido en un Biobonos Descuento 44.00EUR.
Hoja técnica
| Size | 250 ug |
| Gene Name | Tgfb1 |
| Gene Alias | TGF-beta1|TGFbeta1|Tgfb|Tgfb-1 |
| Gene Description | transforming growth factor, beta 1 |
| Storage Conditions | Store at 2ºC to 8ºC for 1 week. For long term storage, aliquot and store at -20ºC to -80ºC.<br>Aliquot to avoid repeated freezing and thawing. |
| Application Key | SDS-PAGE |
| Immunogen Prot. Seq | MGSSHHHHHHSSGLVPRGSHMGSALDTNYCFSSTEKNCCVRQLYIDFRKDLGWKWIHEPKGYHANFCLGPCPYIWSLDTQYSKVLALYNQHNPGASASPCCVPQALEPLPIVYYVGRKPKVEQLSNMIVRSCKCS |
| Form | Liquid |
| Recomended Dilution | SDS-PAGE<br>Denatured<br>The optimal working dilution should be determined by the end user. |
| Antigen species Target species | Mouse |
| Quality control testing | 3ug by SDS-PAGE under reducing condition and visualized by coomassie blue stain. |
| Storage Buffer | In 20mM Tris-HCl buffer, pH8.0 (10% glycerol). |
| Gene ID | 21803 |
Más información
Mouse Tgfb1 (NP_035707, 279 a.a. - 390 a.a ) partial recombinant protein with His tag expressed in Escherichia coli.