Tgfb1 (Mouse) Recombinant Protein
  • Tgfb1 (Mouse) Recombinant Protein

Tgfb1 (Mouse) Recombinant Protein

Ref: AB-P7768
Tgfb1 (Mouse) Recombinant Protein

Información del producto

Mouse Tgfb1 (NP_035707, 279 a.a. - 390 a.a ) partial recombinant protein with His tag expressed in Escherichia coli.
Información adicional
Size 250 ug
Gene Name Tgfb1
Gene Alias TGF-beta1|TGFbeta1|Tgfb|Tgfb-1
Gene Description transforming growth factor, beta 1
Storage Conditions Store at 2C to 8C for 1 week. For long term storage, aliquot and store at -20C to -80C.
Aliquot to avoid repeated freezing and thawing.
Application Key SDS-PAGE
Immunogen Prot. Seq MGSSHHHHHHSSGLVPRGSHMGSALDTNYCFSSTEKNCCVRQLYIDFRKDLGWKWIHEPKGYHANFCLGPCPYIWSLDTQYSKVLALYNQHNPGASASPCCVPQALEPLPIVYYVGRKPKVEQLSNMIVRSCKCS
Form Liquid
Recomended Dilution SDS-PAGE
Denatured
The optimal working dilution should be determined by the end user.
Antigen species Target species Mouse
Quality control testing 3ug by SDS-PAGE under reducing condition and visualized by coomassie blue stain.
Storage Buffer In 20mM Tris-HCl buffer, pH8.0 (10% glycerol).
Gene ID 21803

Enviar un mensaje


Tgfb1 (Mouse) Recombinant Protein

Tgfb1 (Mouse) Recombinant Protein