BNIP1 (Human) Recombinant Protein
  • BNIP1 (Human) Recombinant Protein

BNIP1 (Human) Recombinant Protein

Ref: AB-P7762
BNIP1 (Human) Recombinant Protein

Información del producto

Human BNIP1 (NP_001196, 1 a.a. - 199 a.a ) partial recombinant protein with His tag expressed in Escherichia coli.
Información adicional
Size 500 ug
Gene Name BNIP1
Gene Alias NIP1|SEC20|TRG-8
Gene Description BCL2/adenovirus E1B 19kDa interacting protein 1
Storage Conditions Store at 2C to 8C for 1 week. For long term storage, aliquot and store at -20C to -80C.
Aliquot to avoid repeated freezing and thawing.
Application Key SDS-PAGE
Immunogen Prot. Seq MGSSHHHHHHSSGLVPRGSHMGSMAAPQDVHVRICNQEIVKFDLEVKALIQDIRDCSGPLSALTELNTKVKEKFQQLRHRIQDLEQLAKEQDKESEKQLLLQEVENHKKQMLSNQASWRKANLTCKIAIDNLEKAELLQGGDLLRQRKTTKESLAQTSSTITESLMGISRMMAQQVQQSEEAMQSLVTSSRTILDANEEFKSMSGTIQLGRKLITKYNRREL
Form Liquid
Recomended Dilution SDS-PAGE
Denatured
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Quality control testing 3ug by SDS-PAGE under reducing condition and visualized by coomassie blue stain.
Storage Buffer In 20mM Tris-HCl buffer, pH8.0 (10% glycerol).
Gene ID 662

Enviar un mensaje


BNIP1 (Human) Recombinant Protein

BNIP1 (Human) Recombinant Protein