MRPL2 (Human) Recombinant Protein
  • MRPL2 (Human) Recombinant Protein

MRPL2 (Human) Recombinant Protein

Ref: AB-P7754
MRPL2 (Human) Recombinant Protein

Información del producto

Human MRPL2 (NP_0570341, 82 a.a. - 202 a.a ) partial recombinant protein with His tag expressed in Escherichia coli.
Información adicional
Size 500 ug
Gene Name MRPL2
Gene Alias CGI-22|MRP-L14|RPML14
Gene Description mitochondrial ribosomal protein L2
Storage Conditions Store at 2C to 8C for 1 week. For long term storage, aliquot and store at -20C to -80C.
Aliquot to avoid repeated freezing and thawing.
Application Key SDS-PAGE
Immunogen Prot. Seq MGSSHHHHHHSSGLVPRGSHMGSGRDHTGRIRVHGIGGGHKQRYRMIDFLRFRPEETKSGPFEEKVIQVRYDPCRSADIALVAGGSRKRWIIATENMQAGDTILNSNHIGRMAVAAREGDAHPLGALPVGTLINNVESEPGR
Form Liquid
Recomended Dilution SDS-PAGE
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Quality control testing 3ug by SDS-PAGE under reducing condition and visualized by coomassie blue stain.
Storage Buffer In 20mM Phosphate buffer, pH8.0 (1mM EDTA,2mM DTT, 50% glycerol).
Gene ID 51069

Enviar un mensaje


MRPL2 (Human) Recombinant Protein

MRPL2 (Human) Recombinant Protein