Ver mas grande
MRPL2 (Human) Recombinant Protein
AB-P7754
Producto nuevo
MRPL2 (Human) Recombinant Protein
Comprando este producto generará 11 Biopuntos. Su cesta contiene un total 11 Biopuntos puede ser convertido en un Biobonos Descuento 44.00EUR.
Hoja técnica
| Size | 500 ug |
| Gene Name | MRPL2 |
| Gene Alias | CGI-22|MRP-L14|RPML14 |
| Gene Description | mitochondrial ribosomal protein L2 |
| Storage Conditions | Store at 2ºC to 8ºC for 1 week. For long term storage, aliquot and store at -20ºC to -80ºC.<br>Aliquot to avoid repeated freezing and thawing. |
| Application Key | SDS-PAGE |
| Immunogen Prot. Seq | MGSSHHHHHHSSGLVPRGSHMGSGRDHTGRIRVHGIGGGHKQRYRMIDFLRFRPEETKSGPFEEKVIQVRYDPCRSADIALVAGGSRKRWIIATENMQAGDTILNSNHIGRMAVAAREGDAHPLGALPVGTLINNVESEPGR |
| Form | Liquid |
| Recomended Dilution | SDS-PAGE<br>The optimal working dilution should be determined by the end user. |
| Antigen species Target species | Human |
| Quality control testing | 3ug by SDS-PAGE under reducing condition and visualized by coomassie blue stain. |
| Storage Buffer | In 20mM Phosphate buffer, pH8.0 (1mM EDTA,2mM DTT, 50% glycerol). |
| Gene ID | 51069 |
Más información
Human MRPL2 (NP_0570341, 82 a.a. - 202 a.a ) partial recombinant protein with His tag expressed in Escherichia coli.