METTL21D (Human) Recombinant Protein
  • METTL21D (Human) Recombinant Protein

METTL21D (Human) Recombinant Protein

Ref: AB-P7753
METTL21D (Human) Recombinant Protein

Información del producto

Human METTL21D (NP_078834, 1 a.a. - 229 a.a ) full-length recombinant protein with His tag expressed in Escherichia coli.
Información adicional
Size 500 ug
Gene Name METTL21D
Gene Alias C14orf138
Gene Description methyltransferase like 21D
Storage Conditions Store at 2C to 8C for 1 week. For long term storage, aliquot and store at -20C to -80C.
Aliquot to avoid repeated freezing and thawing.
Application Key SDS-PAGE
Immunogen Prot. Seq MGSSHHHHHHSSGLVPRGSHMGSMADTLESSLEDPLRSFVRVLEKRDGTVLRLQQYSSGGVGCVVWDAAIVLSKYLETPEFSGDGAHALSRRSVLELGSGTGAVGLMAATLGADVVVTDLEELQDLLKMNINMNKHLVTGSVQAKVLKWGEEIEGFPSPPDFILMADCIYYEESLEPLLKTLKDISGFETCIICCYEQRTMGKNPEIEKKYFELLQLDFDFEKIPLEKHDEEYRSEDIHIIYIRKKKSKFPS
Form Liquid
Recomended Dilution SDS-PAGE
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Quality control testing 3ug by SDS-PAGE under reducing condition and visualized by coomassie blue stain.
Storage Buffer In PBS, pH 7.4 (1 mM DTT, 10% glycerol).
Gene ID 79609

Enviar un mensaje


METTL21D (Human) Recombinant Protein

METTL21D (Human) Recombinant Protein