Ver mas grande
POLR2K (Human) Recombinant Protein
AB-P7742
Producto nuevo
POLR2K (Human) Recombinant Protein
Comprando este producto generará 11 Biopuntos. Su cesta contiene un total 11 Biopuntos puede ser convertido en un Biobonos Descuento 44.00EUR.
Hoja técnica
| Size | 250 ug |
| Gene Name | POLR2K |
| Gene Alias | ABC10-alpha|RPABC4|RPB10alpha|RPB12|RPB7.0|hRPB7.0|hsRPB10a |
| Gene Description | polymerase (RNA) II (DNA directed) polypeptide K, 7.0kDa |
| Storage Conditions | Store at 2ºC to 8ºC for 1 week. For long term storage, aliquot and store at -20ºC to -80ºC.<br>Aliquot to avoid repeated freezing and thawing. |
| Concentration | 0.5mg/mL |
| Application Key | SDS-PAGE |
| Immunogen Prot. Seq | MGSSHHHHHHSSGLVPRGSHMGSMDTQKDVQPPKQQPMIYICGECHTENEIKSRDPIRCRECGYRIMYKKRTKRLVVFDAR |
| Form | Liquid |
| Recomended Dilution | SDS-PAGE<br>The optimal working dilution should be determined by the end user. |
| Antigen species Target species | Human |
| Quality control testing | 3ug by SDS-PAGE under reducing condition and visualized by coomassie blue stain. |
| Storage Buffer | In PBS, pH 7.4 (1 mM DTT, 10% glycerol). |
| Gene ID | 5440 |
Más información
Human POLR2K (NP_005025, 1 a.a. - 58 a.a ) full-length recombinant protein with His tag expressed in Escherichia coli.