AB-P7736
Producto nuevo
Este producto ya no esta disponible
Fecha disponibilidad
Comprando este producto generará 11 Biopuntos. Su cesta contiene un total 11 Biopuntos puede ser convertido en un Biobonos Descuento 44.00EUR.
Size | 250 ug |
Gene Name | RPL7A |
Gene Alias | SURF3|TRUP |
Gene Description | ribosomal protein L7a |
Storage Conditions | Store at 2ºC to 8ºC for 1 week. For long term storage, aliquot and store at -20ºC to -80ºC.<br>Aliquot to avoid repeated freezing and thawing. |
Concentration | 1mg/mL |
Application Key | SDS-PAGE |
Immunogen Prot. Seq | MGSSHHHHHHSSGLVPRGSHMGSMPKGKKAKGKKVAPAPAVVKKQEAKKVVNPLFEKRPKNFGIGQDIQPKRDLTRFVKWPRYIRLQRQRAILYKRLKVPPAINQFTQALDRQTATQLLKLAHKYRPETKQEKKQRLLARAEKKAAGKGDVPTKRPPVLRAGVNTVTTLVENKKAQLVVIAHDVDPIELVVFLPALCRKMGVPYCIIKGKARLGRLVHRKTCTTVAFTQVNSEDKGALAKLVEAIRTNYNDRYDE |
Form | Liquid |
Recomended Dilution | SDS-PAGE<br>Denatured<br>The optimal working dilution should be determined by the end user. |
Antigen species Target species | Human |
Quality control testing | 3ug by SDS-PAGE under reducing condition and visualized by coomassie blue stain. |
Storage Buffer | In 20 mM Tris-HCl buffer, pH 8.0 (10% glycerol). |
Gene ID | 6130 |