Il1a (Mouse) Recombinant Protein
  • Il1a (Mouse) Recombinant Protein

Il1a (Mouse) Recombinant Protein

Ref: AB-P7713
Il1a (Mouse) Recombinant Protein

Información del producto

Mouse Il1a (NP_034684, 115 a.a. - 270 a.a ) partial recombinant protein with His tag expressed in Escherichia coli.
Información adicional
Size 500 ug
Gene Name Il1a
Gene Alias Il-1a
Gene Description interleukin 1 alpha
Storage Conditions Store at 2C to 8C for 1 week. For long term storage, aliquot and store at -20C to -80C.
Aliquot to avoid repeated freezing and thawing.
Concentration 1mg/mL
Application Key SDS-PAGE
Immunogen Prot. Seq MGSSHHHHHHSSGLVPRGSHMGSSAPYTYQSDLRYKLMKLVRQKFVMNDSLNQTIYQDVDKHYLSTTWLNDLQQEVKFDMYAYSSGGDDSKYPVTLKISDSQLFVSAQGEDQPVLLKELPETPKLITGSETDLIFFWKSINSKNYFTSAAYPELFIATKEQSRVHLARGLPSMTDFQIS
Form Liquid
Recomended Dilution SDS-PAGE
Denatured
The optimal working dilution should be determined by the end user.
Antigen species Target species Mouse
Quality control testing 3ug by SDS-PAGE under reducing condition and visualized by coomassie blue stain.
Storage Buffer In PBS, pH 7.4 (10% glycerol).
Gene ID 16175

Enviar un mensaje


Il1a (Mouse) Recombinant Protein

Il1a (Mouse) Recombinant Protein