Ver mas grande
Il1a (Mouse) Recombinant Protein
AB-P7713
Producto nuevo
Il1a (Mouse) Recombinant Protein
Comprando este producto generará 8 Biopuntos. Su cesta contiene un total 8 Biopuntos puede ser convertido en un Biobonos Descuento 32.00EUR.
Hoja técnica
| Size | 500 ug |
| Gene Name | Il1a |
| Gene Alias | Il-1a |
| Gene Description | interleukin 1 alpha |
| Storage Conditions | Store at 2ºC to 8ºC for 1 week. For long term storage, aliquot and store at -20ºC to -80ºC.<br>Aliquot to avoid repeated freezing and thawing. |
| Concentration | 1mg/mL |
| Application Key | SDS-PAGE |
| Immunogen Prot. Seq | MGSSHHHHHHSSGLVPRGSHMGSSAPYTYQSDLRYKLMKLVRQKFVMNDSLNQTIYQDVDKHYLSTTWLNDLQQEVKFDMYAYSSGGDDSKYPVTLKISDSQLFVSAQGEDQPVLLKELPETPKLITGSETDLIFFWKSINSKNYFTSAAYPELFIATKEQSRVHLARGLPSMTDFQIS |
| Form | Liquid |
| Recomended Dilution | SDS-PAGE<br>Denatured<br>The optimal working dilution should be determined by the end user. |
| Antigen species Target species | Mouse |
| Quality control testing | 3ug by SDS-PAGE under reducing condition and visualized by coomassie blue stain. |
| Storage Buffer | In PBS, pH 7.4 (10% glycerol). |
| Gene ID | 16175 |
Más información
Mouse Il1a (NP_034684, 115 a.a. - 270 a.a ) partial recombinant protein with His tag expressed in Escherichia coli.