FHL2 (Human) Recombinant Protein Ver mas grande

FHL2 (Human) Recombinant Protein

AB-P7708

Producto nuevo

FHL2 (Human) Recombinant Protein

Más detalles

Por favor regístrese para ver el precio

Comprando este producto generará 11 Biopuntos. Su cesta contiene un total 11 Biopuntos puede ser convertido en un Biobonos Descuento 44.00EUR.


Hoja técnica

Size 500 ug
Gene Name FHL2
Gene Alias AAG11|DRAL|SLIM3
Gene Description four and a half LIM domains 2
Storage Conditions Store at 2ºC to 8ºC for 1 week. For long term storage, aliquot and store at -20ºC to -80ºC.<br>Aliquot to avoid repeated freezing and thawing.
Concentration 0.5mg/mL
Application Key SDS-PAGE
Immunogen Prot. Seq MGSSHHHHHHSSGLVPRGSHMGSMTERFDCHHCNESLFGKKYILREESPYCVVCFETLFANTCEECGKPIGCDCKDLSYKDRHWHEACFHCSQCRNSLVDKPFAAKEDQLLCTDCYSNEYSSKCQECKKTIMPGTRKMEYKGSSWHETCFICHRCQQPIGTKSFIPKDNQNFCVPCYEKQHAMQCVQCKKPITTGGVTYREQPWHKECFVCTACRKQLSGQRFTARDDFAYCLNCFCDLYAKKCAGCTNPISGLG
Form Liquid
Recomended Dilution SDS-PAGE<br>Denatured<br>The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Quality control testing 3ug by SDS-PAGE under reducing condition and visualized by coomassie blue stain.
Storage Buffer In 20 mM Tris-HCl buffer, pH 8.0 (10% glycerol).
Gene ID 2274

Más información

Human FHL2 (NP_001034581, 1 a.a. - 279 a.a ) full-length recombinant protein with His tag expressed in Escherichia coli.

Consulta sobre un producto

FHL2 (Human) Recombinant Protein

FHL2 (Human) Recombinant Protein