HYKK (Human) Recombinant Protein
  • HYKK (Human) Recombinant Protein

HYKK (Human) Recombinant Protein

Ref: AB-P7705
HYKK (Human) Recombinant Protein

Información del producto

Human HYKK (NP_001013641, 1 a.a. - 373 a.a ) full-length recombinant protein with His tag expressed in Escherichia coli.
Información adicional
Size 250 ug
Gene Name HYKK
Gene Alias AGPHD1
Gene Description hydroxylysine kinase
Storage Conditions Store at 2C to 8C for 1 week. For long term storage, aliquot and store at -20C to -80C.
Aliquot to avoid repeated freezing and thawing.
Concentration 0.5mg/mL
Application Key SDS-PAGE
Immunogen Prot. Seq MGSSHHHHHHSSGLVPRGSHMGSMSSGNYQQSEALSKPTFSEEQASALVESVFGLKVSKVRPLPSYDDQNFHVYVSKTKDGPTEYVLKISNTKASKNPDLIEVQNHIIMFLKAAGFPTASVCHTKGDNTASLVSVDSGSEIKSYLVRLLTYLPGRPIAELPVSPQLLYEIGKLAAKLDKTLQRFHHPKLSSLHRENFIWNLKNVPLLEKYLYALGQNRNREIVEHVIHLFKEEVMTKLSHFRECINHGDLNDHNI
Form Liquid
Recomended Dilution SDS-PAGE
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Quality control testing 3ug by SDS-PAGE under reducing condition and visualized by coomassie blue stain.
Storage Buffer In PBS, pH 7.4 (0.1mM PMSF, 1mM DTT, 40% glycerol).
Gene ID 123688

Enviar un mensaje


HYKK (Human) Recombinant Protein

HYKK (Human) Recombinant Protein