HERPUD1 (Human) Recombinant Protein
  • HERPUD1 (Human) Recombinant Protein

HERPUD1 (Human) Recombinant Protein

Ref: AB-P7702
HERPUD1 (Human) Recombinant Protein

Información del producto

Human HERPUD1 (NP_055500, 1 a.a. - 263 a.a ) partial recombinant protein with His tag expressed in Escherichia coli.
Información adicional
Size 250 ug
Gene Name HERPUD1
Gene Alias HERP|KIAA0025|Mif1|SUP
Gene Description homocysteine-inducible, endoplasmic reticulum stress-inducible, ubiquitin-like domain member 1
Storage Conditions Store at 2C to 8C for 1 week. For long term storage, aliquot and store at -20C to -80C.
Aliquot to avoid repeated freezing and thawing.
Concentration 0.5mg/mL
Application Key SDS-PAGE
Immunogen Prot. Seq MGSSHHHHHHSSGLVPRGSHMGSMESETEPEPVTLLVKSPNQRHRDLELSGDRGWSVGHLKAHLSRVYPERPRPEDQRLIYSGKLLLDHQCLRDLLPKQEKRHVLHLVCNVKSPSKMPEINAKVAESTEEPAGSNRGQYPEDSSSDGLRQREVLRNLSSPGWENISRPEAAQQAFQGLGPGFSGYTPYGWLQLSWFQQIYARQYYMQYLAATAASGAFVPPPSAQEIPVVSAPAPAPIHNQFPAENQPANQNAAP
Form Liquid
Recomended Dilution SDS-PAGE
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Quality control testing 3ug by SDS-PAGE under reducing condition and visualized by coomassie blue stain.
Storage Buffer In PBS, pH 7.4 (10% glycerol).
Gene ID 9709

Enviar un mensaje


HERPUD1 (Human) Recombinant Protein

HERPUD1 (Human) Recombinant Protein