GBA3 (Human) Recombinant Protein
  • GBA3 (Human) Recombinant Protein

GBA3 (Human) Recombinant Protein

Ref: AB-P7700
GBA3 (Human) Recombinant Protein

Información del producto

Human GBA3 (NP_066024, 1 a.a. - 469 a.a ) full-length recombinant protein with His tag expressed in Escherichia coli.
Información adicional
Size 500 ug
Gene Name GBA3
Gene Alias CBGL1|GLUC|KLrP|MGC104276|MGC126878
Gene Description glucosidase, beta, acid 3 (cytosolic)
Storage Conditions Store at 2C to 8C for 1 week. For long term storage, aliquot and store at -20C to -80C.
Aliquot to avoid repeated freezing and thawing.
Concentration 0.25mg/mL
Application Key SDS-PAGE
Immunogen Prot. Seq MGSSHHHHHHSSGLVPRGSHMGSMAFPAGFGWAAATAAYQVEGGWDADGKGPCVWDTFTHQGGERVFKNQTGDVACGSYTLWEEDLKCIKQLGLTHYRFSLSWSRLLPDGTTGFINQKGIDYYNKIIDDLLKNGVTPIVTLYHFDLPQTLEDQGGWLSEAIIESFDKYAQFCFSTFGDRVKQWITINEANVLSVMSYDLGMFPPGIPHFGTGGYQAAHNLIKAHARSWHSYDSLFRKKQKGMVSLSLFAVWLEPA
Form Liquid
Recomended Dilution SDS-PAGE
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Quality control testing 3ug by SDS-PAGE under reducing condition and visualized by coomassie blue stain.
Storage Buffer In PBS, pH 7.4 (1 mM DTT, 20% glycerol).
Gene ID 57733

Enviar un mensaje


GBA3 (Human) Recombinant Protein

GBA3 (Human) Recombinant Protein