IL12 (p35 & p40) (Human) Recombinant Protein
  • IL12 (p35 & p40) (Human) Recombinant Protein

IL12 (p35 & p40) (Human) Recombinant Protein

Ref: AB-P7694
IL12 (p35 & p40) (Human) Recombinant Protein

Información del producto

Human IL12 p35 (P29459, 23 a.a.- 219 a.a.) and IL12 p40 (P29460, 23 a.a.- 328 a.a.) partial recombinant protein with His tag expressed in Baculovirus expression system.
Información adicional
Size 250 ug
Gene Name IL12A
Gene Alias CLMF|IL-12A|NFSK|NKSF1|P35
Gene Description interleukin 12A (natural killer cell stimulatory factor 1, cytotoxic lymphocyte maturation factor 1, p35)
Storage Conditions Store at 2C to 8C for 1 week. For long term storage, aliquot and store at -20C to -80C.
Aliquot to avoid repeated freezing and thawing.
Concentration 0.5mg/mL
Application Key Func,SDS-PAGE
Immunogen Prot. Seq IL12B(p40)_x005F_x000D__x000D_IWELKKDVYVVELDWYPDAPGEMVVLTCDTPEEDGITWTLDQSSEVLGSGKTLTIQVKEFGDAGQYTCHKGGEVLSHSLLLLHKKEDGIWSTDILKDQKEPKNKTFLRCEAKNYSGRFTCWWLTTISTDLTFSVKSSRGSSDPQGVTCGAATLSAERVRGDNKEYEYSVECQEDSACPAAEESLPIEVMVDAVHKLKYENYTSSFFIRDIIKPDPPKNLQLKPLK
Form Liquid
Recomended Dilution SDS-PAGE
Bioactivity
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Quality control testing 3ug by SDS-PAGE under reducing condition and visualized by coomassie blue stain.
Storage Buffer In PBS, pH 7.4 (10% glycerol).
Gene ID 3592|3593

Enviar un mensaje


IL12 (p35 & p40) (Human) Recombinant Protein

IL12 (p35 & p40) (Human) Recombinant Protein