EDAR (Human) Recombinant Protein
  • EDAR (Human) Recombinant Protein

EDAR (Human) Recombinant Protein

Ref: AB-P7680
EDAR (Human) Recombinant Protein

Información del producto

Human EDAR (NP_071731, 27 a.a. - 448 a.a ) partial recombinant protein with His tag expressed in Escherichia coli.
Información adicional
Size 500 ug
Gene Name EDAR
Gene Alias DL|ED1R|ED3|ED5|EDA-A1R|EDA1R|EDA3|FLJ94390
Gene Description ectodysplasin A receptor
Storage Conditions Store at 2C to 8C for 1 week. For long term storage, aliquot and store at -20C to -80C.
Aliquot to avoid repeated freezing and thawing.
Concentration 0.25mg/mL
Application Key SDS-PAGE
Immunogen Prot. Seq MGSSHHHHHHSSGLVPRGSHMGSEYSNCGENEYYNQTTGLCQECPPCGPGEEPYLSCGYGTKDEDYGCVPCPAEKFSKGGYQICRRHKDCEGFFRATVLTPGDMENDAECGPCLPGYYMLENRPRNIYGMVCYSCLLAPPNTKECVGATSGASANFPGTSGSSTLSPFQHAHKELSGQGHLATALIIAMSTIFIMAIAIVLIIMFYILKTKPSAPACCTSHPGKSVEAQVSKDEEKKEAPDNVVMFSEKDEFEKL
Form Liquid
Recomended Dilution SDS-PAGE
Denatured
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Quality control testing 3ug by SDS-PAGE under reducing condition and visualized by coomassie blue stain.
Storage Buffer In 20 mM Tris-HCl buffer, pH 8.0 (10% glycerol).
Gene ID 10913

Enviar un mensaje


EDAR (Human) Recombinant Protein

EDAR (Human) Recombinant Protein