CXCL6 (Human) Recombinant Protein
  • CXCL6 (Human) Recombinant Protein

CXCL6 (Human) Recombinant Protein

Ref: AB-P7664
CXCL6 (Human) Recombinant Protein

Información del producto

Human CXCL6 (P80162, 43 a.a. - 114 a.a.) partial recombinant protein expressed in Escherichia coli.
Información adicional
Size 1 mg
Gene Name CXCL6
Gene Alias CKA-3|GCP-2|GCP2|SCYB6
Gene Description chemokine (C-X-C motif) ligand 6 (granulocyte chemotactic protein 2)
Storage Conditions Store at 4C to 8C for 1 week. For long term storage store at -20C to -80C.
Aliquot to avoid repeated freezing and thawing.
Application Key Func,SDS-PAGE
Immunogen Prot. Seq VLTELRCTCLRVTLRVNPKTIGKLQVFPAGPQCSKVEVVASLKNGKQVCLDPEAPFLKKVIQKILDSGNKKN
Form Lyophilized
Storage Buffer Lyophilized from sterile distilled Water up to 0.1 - 1.0 mg/mL
Gene ID 6372

Enviar un mensaje


CXCL6 (Human) Recombinant Protein

CXCL6 (Human) Recombinant Protein