CD22 (Human) Recombinant Protein
  • CD22 (Human) Recombinant Protein

CD22 (Human) Recombinant Protein

Ref: AB-P7654
CD22 (Human) Recombinant Protein

Información del producto

Human CD22 (P20273, 20 a.a. - 687 a.a.) partial recombinant protein with hFc tag at C-terminus expressed in Expi293 cells.
Información adicional
Size 100 ug
Gene Name CD22
Gene Alias FLJ22814|MGC130020|SIGLEC-2|SIGLEC2
Gene Description CD22 molecule
Storage Conditions Store at -80C.
Aliquot to avoid repeated freezing and thawing.
Application Key Func,SDS-PAGE
Immunogen Prot. Seq DSSKWVFEHPETLYAWEGACVWIPCTYRALDGDLESFILFHNPEYNKNTSKFDGTRLYESTKDGKVPSEQKRVQFLGDKNKNCTLSIHPVHLNDSGQLGLRMESKTEKWMERIHLNVSERPFPPHIQLPPEIQESQEVTLTCLLNFSCYGYPIQLQWLLEGVPMRQAAVTSTSLTIKSVFTRSELKFSPQWSHHGKIVTCQLQDADGKFLSNDTVQLNVKHTPKLEIKVTPSDAIVREGDSVTMTCEVSSSNPEY
Form Lyophilized
Quality control testing SDS-PAGE under reducing condition
Storage Buffer Lyophilized from sterile distilled Water up to 100 ug/mL
Gene ID 933

Enviar un mensaje


CD22 (Human) Recombinant Protein

CD22 (Human) Recombinant Protein