MS4A1 (Human) Recombinant Protein
  • MS4A1 (Human) Recombinant Protein

MS4A1 (Human) Recombinant Protein

Ref: AB-P7647
MS4A1 (Human) Recombinant Protein

Información del producto

Human MS4A1 (P11836, 141 a.a. - 188 a.a.) partial recombinant protein with His-Avi tag at C-terminus expressed in Escherichia coli.
Información adicional
Size 100 ug
Gene Name MS4A1
Gene Alias B1|Bp35|CD20|LEU-16|MGC3969|MS4A2|S7
Gene Description membrane-spanning 4-domains, subfamily A, member 1
Storage Conditions Store at 4C to 8C for 1 week. For long term storage store at -20C to -80C.
Aliquot to avoid repeated freezing and thawing.
Application Key Func,SDS-PAGE
Immunogen Prot. Seq IKISHFLKMESLNFIRAHTPYINIYNCEPANPSEKNSPSTQYCYSIQS
Form Liquid
Quality control testing SDS-PAGE under reducing condition
Storage Buffer In PB solution, pH 7.0 (10% glycerol)
Gene ID 931

Enviar un mensaje


MS4A1 (Human) Recombinant Protein

MS4A1 (Human) Recombinant Protein