NT5E (Human) Recombinant Protein
  • NT5E (Human) Recombinant Protein

NT5E (Human) Recombinant Protein

Ref: AB-P7646
NT5E (Human) Recombinant Protein

Información del producto

Human NT5E (P21589, 27 a.a. - 547 a.a.) partial recombinant protein with His tag at C-terminus expressed in Expi293 cells.
Información adicional
Size 1 mg
Gene Name NT5E
Gene Alias CD73|E5NT|NT|NT5|NTE|eN|eNT
Gene Description 5'-nucleotidase, ecto (CD73)
Storage Conditions Store at -80C.
Aliquot to avoid repeated freezing and thawing.
Application Key Func,SDS-PAGE
Immunogen Prot. Seq WELTILHTNDVHSRLEQTSEDSSKCVNASRCMGGVARLFTKVQQIRRAEPNVLLLDAGDQYQGTIWFTVYKGAEVAHFMNALRYDAMALGNHEFDNGVEGLIEPLLKEAKFPILSANIKAKGPLASQISGLYLPYKVLPVGDEVVGIVGYTSKETPFLSNPGTNLVFEDEITALQPEVDKLKTLNVNKIIALGHSGFEMDKLIAQKVRGVDVVVGGHSNTFLYTGNPPSKEVPAGKYPFIVTSDDGRKVPVVQAY
Form Liquid
Quality control testing SDS-PAGE under reducing condition
Storage Buffer In 20 mM Tris, 120 mM NaCl, pH 7.5 (20% glycerol, 4 mM CaCl2).
Gene ID 4907

Enviar un mensaje


NT5E (Human) Recombinant Protein

NT5E (Human) Recombinant Protein