IL5RA (Human) Recombinant Protein
  • IL5RA (Human) Recombinant Protein

IL5RA (Human) Recombinant Protein

Ref: AB-P7639
IL5RA (Human) Recombinant Protein

Información del producto

Human IL5RA (Q01344, 21 a.a. - 335 a.a.) partial recombinant protein with His tag at C-terminus expressed in Human cells.
Información adicional
Size 10 ug
Gene Name IL5RA
Gene Alias CD125|CDw125|HSIL5R3|IL5R|MGC26560
Gene Description interleukin 5 receptor, alpha
Storage Conditions Store at 4C to 8C for 1 week. For long term storage store at -20C to -80C.
Aliquot to avoid repeated freezing and thawing.
Application Key SDS-PAGE
Immunogen Prot. Seq DLLPDEKISLLPPVNFTIKVTGLAQVLLQWKPNPDQEQRNVNLEYQVKINAPKEDDYETRITESKCVTILHKGFSASVRTILQNDHSLLASSWASAELHAPPGSPGTSIVNLTCTTNTTEDNYSRLRSYQVSLHCTWLVGTDAPEDTQYFLYYRYGSWTEECQEYSKDTLGRNIACWFPRTFILSKGRDWLAVLVNGSSKHSAIRPFDQLFALHAIDQINPPLNVTAEIEGTRLSIQWEKPVSAFPIHCFDYEVK
Form Lyophilized
Storage Buffer Lyophilized from sterile distilled Water up to 100 ug/mL
Gene ID 3568

Enviar un mensaje


IL5RA (Human) Recombinant Protein

IL5RA (Human) Recombinant Protein