Ccl25 (Mouse) Recombinant Protein
  • Ccl25 (Mouse) Recombinant Protein

Ccl25 (Mouse) Recombinant Protein

Ref: AB-P7635
Ccl25 (Mouse) Recombinant Protein

Información del producto

Mouse Ccl25 (O35903, 24 a.a. - 144 a.a.) partial recombinant protein expressed in Escherichia coli.
Información adicional
Size 1 mg
Gene Name Ccl25
Gene Alias AI852536|CKb15|Scya25|TECK
Gene Description chemokine (C-C motif) ligand 25
Storage Conditions Store at 4C to 8C for 1 week. For long term storage store at -20C to -80C.
Aliquot to avoid repeated freezing and thawing.
Application Key Func,SDS-PAGE
Immunogen Prot. Seq QGAFEDCCLGYQHRIKWNVLRHARNYHQQEVSGSCNLRAVRFYFRQKVVCGNPEDMNVKRAMRILTARKRLVHWKSASDSQTERKKSNHMKSKVENPNSTSVRSATLGHPRMVMMPRKTNN
Form Lyophilized
Storage Buffer Lyophilized from sterile distilled Water up to 0.1 - 1.0 mg/mL
Gene ID 20300

Enviar un mensaje


Ccl25 (Mouse) Recombinant Protein

Ccl25 (Mouse) Recombinant Protein