IL1B (Porcine) Recombinant Protein
  • IL1B (Porcine) Recombinant Protein

IL1B (Porcine) Recombinant Protein

Ref: AB-P7634
IL1B (Porcine) Recombinant Protein

Información del producto

Porcine IL1B (P26889, 115 a.a. - 267 a.a.) partial recombinant protein expressed in Escherichia coli.
Información adicional
Size 1 mg
Gene Name IL1B
Gene Alias -
Gene Description interleukin 1, beta
Storage Conditions Store at 4C to 8C for 1 week. For long term storage store at -20C to -80C.
Aliquot to avoid repeated freezing and thawing.
Application Key Func,SDS-PAGE
Immunogen Prot. Seq ANVQSMECKLQDKDHKSLVLAGPHMLKALHLLTGDLKREVVFCMSFVQGDDSNNKIPVTLGIKGKNLYLSCVMKDNTPTLQLEDIDPKRYPKRDMEKRFVFYKTEIKNRVEFESALYPNWYISTSQAEQKPVFLGNSKGRQDITDFTMEVLSP
Form Lyophilized
Storage Buffer Lyophilized from sterile distilled Water up to 0.1 - 1.0 mg/mL
Gene ID 397122

Enviar un mensaje


IL1B (Porcine) Recombinant Protein

IL1B (Porcine) Recombinant Protein