Ver mas grande
IL1B (Porcine) Recombinant Protein
AB-P7634
Producto nuevo
IL1B (Porcine) Recombinant Protein
Comprando este producto generará 69 Biopuntos. Su cesta contiene un total 69 Biopuntos puede ser convertido en un Biobonos Descuento 276.00EUR.
Hoja técnica
| Size | 1 mg |
| Gene Name | IL1B |
| Gene Alias | - |
| Gene Description | interleukin 1, beta |
| Storage Conditions | Store at 4ºC to 8ºC for 1 week. For long term storage store at -20ºC to -80ºC.<br>Aliquot to avoid repeated freezing and thawing. |
| Application Key | Func,SDS-PAGE |
| Immunogen Prot. Seq | ANVQSMECKLQDKDHKSLVLAGPHMLKALHLLTGDLKREVVFCMSFVQGDDSNNKIPVTLGIKGKNLYLSCVMKDNTPTLQLEDIDPKRYPKRDMEKRFVFYKTEIKNRVEFESALYPNWYISTSQAEQKPVFLGNSKGRQDITDFTMEVLSP |
| Form | Lyophilized |
| Storage Buffer | Lyophilized from sterile distilled Water up to 0.1 - 1.0 mg/mL |
| Gene ID | 397122 |
Más información
Porcine IL1B (P26889, 115 a.a. - 267 a.a.) partial recombinant protein expressed in Escherichia coli.