Ifng (Rat) Recombinant Protein
  • Ifng (Rat) Recombinant Protein

Ifng (Rat) Recombinant Protein

Ref: AB-P7633
Ifng (Rat) Recombinant Protein

Información del producto

Rat Ifng (P01581, 23 a.a. - 156 a.a.) partial recombinant protein expressed in Escherichia coli.
Información adicional
Size 1 mg
Gene Name Ifng
Gene Alias IFNG2
Gene Description interferon gamma
Storage Conditions Store at 4C to 8C for 1 week. For long term storage store at -20C to -80C.
Aliquot to avoid repeated freezing and thawing.
Application Key Func,SDS-PAGE
Immunogen Prot. Seq QGTLIESLESLKNYFNSSSMDAMEGKSLLLDIWRNWQKDGNTKILESQIISFYLRLFEVLKDNQAISNNISVIESHLITNFFSNSKAKKDAFMSIAKFEVNNPQIQHKAVNELIRVIHQLSPESSLRKRKRSRC
Form Lyophilized
Storage Buffer Lyophilized from 10 mM HActo up to 0.1 - 1.0 mg/mL
Gene ID 25712

Enviar un mensaje


Ifng (Rat) Recombinant Protein

Ifng (Rat) Recombinant Protein