FGF12 (Human) Recombinant Protein
  • FGF12 (Human) Recombinant Protein

FGF12 (Human) Recombinant Protein

Ref: AB-P7622
FGF12 (Human) Recombinant Protein

Información del producto

Human FGF12 (P61328-2, 1 a.a. - 181 a.a.) partial recombinant protein with His tag at C-terminus expressed in Escherichia coli.
Información adicional
Size 1 mg
Gene Name FGF12
Gene Alias FGF12B|FHF1
Gene Description fibroblast growth factor 12
Storage Conditions Store at 4C to 8C for 1 week. For long term storage store at -20C to -80C.
Aliquot to avoid repeated freezing and thawing.
Application Key Func,SDS-PAGE
Immunogen Prot. Seq MESKEPQLKGIVTRLFSQQGYFLQMHPDGTIDGTKDENSDYTLFNLIPVGLRVVAIQGVKASLYVAMNGEGYLYSSDVFTPECKFKESVFENYYVIYSSTLYRQQESGRAWFLGLNKEGQIMKGNRVKKTKPSSHFVPKPIEVCMYREPSLHEIGEKQGRSRKSSGTPTMNGGKVVNQDST
Form Lyophilized
Storage Buffer Lyophilized from sterile distilled Water up to 100 ug/mL
Gene ID 2257

Enviar un mensaje


FGF12 (Human) Recombinant Protein

FGF12 (Human) Recombinant Protein