Pdgfb (Mouse) Recombinant Protein
  • Pdgfb (Mouse) Recombinant Protein

Pdgfb (Mouse) Recombinant Protein

Ref: AB-P7621
Pdgfb (Mouse) Recombinant Protein

Información del producto

Mouse Pdgfb (P31240, 82 a.a. - 190 a.a.) partial recombinant protein with His tag at C-terminus expressed in Escherichia coli.
Información adicional
Size 1 mg
Gene Name Pdgfb
Gene Alias PDGF-B|Sis
Gene Description platelet derived growth factor, B polypeptide
Storage Conditions Store at 4C to 8C for 1 week. For long term storage store at -20C to -80C.
Aliquot to avoid repeated freezing and thawing.
Application Key Func,SDS-PAGE
Immunogen Prot. Seq SLGSLAAAEPAVIAECKTRTEVFQISRNLIDRTNANFLVWPPCVEVQRCSGCCNNRNVQCRASQVQMRPVQVRKIEIVRKKPIFKKATVTLEDHLACKCETIVTPRPVT
Form Lyophilized
Storage Buffer Lyophilized from 4 mM HCl up to 100 ug/mL
Gene ID 18591

Enviar un mensaje


Pdgfb (Mouse) Recombinant Protein

Pdgfb (Mouse) Recombinant Protein