FGL1 (Human) Recombinant Protein
  • FGL1 (Human) Recombinant Protein

FGL1 (Human) Recombinant Protein

Ref: AB-P7617
FGL1 (Human) Recombinant Protein

Información del producto

Human FGL1 (Q08830, 23 a.a. - 312 a.a.) partial recombinant protein with hFc tag at C-terminus expressed in HEK293 cells.
Información adicional
Size 50 ug
Gene Name FGL1
Gene Alias HFREP1|HP-041|LFIRE1|MGC12455
Gene Description fibrinogen-like 1
Storage Conditions Store at 4C to 8C for 1 week. For long term storage store at -20C to -80C.
Aliquot to avoid repeated freezing and thawing.
Application Key Func,SDS-PAGE
Immunogen Prot. Seq LEDCAQEQMRLRAQVRLLETRVKQQQVKIKQLLQENEVQFLDKGDENTVIDLGSKRQYADCSEIFNDGYKLSGFYKIKPLQSPAEFSVYCDMSDGGGWTVIQRRSDGSENFNRGWKDYENGFGNFVQKHGEYWLGNKNLHFLTTQEDYTLKIDLADFEKNSRYAQYKNFKVGDEKNFYELNIGEYSGTAGDSLAGNFHPEVQWWASHQRMKFSTWDRDHDNYEGNCAEEDQSGWWFNRCHSANLNGVYYSGPYTA
Form Lyophilized
Storage Buffer Lyophilized from sterile distilled Water up to 100 ug/mL
Gene ID 2267

Enviar un mensaje


FGL1 (Human) Recombinant Protein

FGL1 (Human) Recombinant Protein